Pasang Iklan Baris Gratis Tanpa Daftar

Kategori: Internet - Web Hosting

Pijat Panggilan Bali 24 Jam Terapis Pria dan Wanita

24 Desember 2020 04:30 | Dibaca 102 kali

Pijat Panggilan Bali 24 Jam Bali Merupakan daerah pariwisata berkelas dunia yang ada di indonesia dan dikenal sebagai Pulau Dewata. Ada banyak Tempat Pijat, Spa dan reflexology mulai dari Berlabel Spa mewah hingga yang biasa biasa Pijat panggilan Bali 24 jam terapis pria dan wanita Semakin banyaknya permintaan menggunakan jasa…

Dikirim Oleh : Sekar Kontak: 081252423168 Link: Kunjungi Website
Alamat: Denpasar Tags: Jasa, pijat bali, pijat panggilan bali, spa bali, reflexology, terapi kesehatan
Iklan Premium

Terima Kost Kebon Kacang

17 Januari 2021 12:31 | Dibaca 87 kali

Dekat Plaza Indonesia, Grand Indonesia, perkantoran, warung makan, klinik, Indomaret, Alfamart, Thamrin city, MRT thamrin. Fasilitas AC, sprinbed, lemari, hexos, waterheater, dapur, air minum, WiFi gratis, kamar mandi luar, listrik token, dan prakir motor Alamat : Kebon Kacang GG XXXI NO.11 RT 06 RW 04 Jakarta Pusat Kontak : Tlpn/WA…

Dikirim Oleh : Linda Kontak: 08111181165 Link: Kunjungi Website
Alamat: Jakarta Pusat Tags: Rumah Kost, kost kostan, kost kebon kacang, terima kost
Iklan Premium

Hosting Murah untuk bisnis anda

07 Februari 2021 22:54 | Dibaca 19 kali

Upgrade sekarang, jangkau banyak pembeli dengan online! Buat website kamu dengan web hosting Niagahoster Kapan lagi beli hosting dapet diskon up to 75% + gratis domain & SSL selamanya. Buat yang belum order, segera order sekarang! Unlimited Hosting https://panel.niagahoster.co.id/ref/429736?r=hosting-murah Cloud Hosting https://panel.niagahoster.co.id/ref/429736?r=cloud-hosting Mail Hosting https://panel.niagahoster.co.id/ref/429736?r=email-hosting

Pengiklan: Riyan Anas setiyawan, Alamat: Lampung selatan, Kontak: 082125141605
Link: Link Website Tags: Web Hosting, hosting, iklan, free ads

Beli hosting mulai Rp 500.000-an, GRATIS domain .co.id/.id/.com

20 Januari 2021 15:22 | Dibaca 25 kali

Paket Web Host Professional 1 tahun+ Domain .CO.ID/.ID/.COM bikin Company Profile Ingin Toko Tokopedia, shopee, bukalapalak, dll anda menjadi lebih terpercaya? Kini anda dpt memiliki Website Company Profile berisi profil usaha anda! Atau sekadar ingin membuat website untuk portfolio anda atau website pribadi anda? Caranya mudah, anda dpt memanfaatkan PAKET…

Pengiklan: septi, Alamat: jakarta pusat, Kontak: 083898019280
Link: Link Website Tags: Web Hosting, hosting, webmail, mai, domain, webhosting

AYO DUKUNG PROGRAM PEMERINTAH

18 Januari 2021 09:06 | Dibaca 23 kali

Kapolri Jenderal (Pol) Idham Azis menjadi anggota kepolisian pertama yang akan menerima suntikan vaksin Covid-19 perdana

Pengiklan: IDLOOS, Alamat: SURABAYA, Kontak: -
Link: Link Website Tags: Web Hosting, kapolrimenjadidaftarpertamapenerimavaksindikorpbhayangkara

Jadikan Bisnis Anda Semakin Profesional dengan Membuat Email dengan Nama Perusahaan Anda

14 Januari 2021 13:46 | Dibaca 30 kali

STABIL Kami tetap mengelola dari tahun 1999 sampai hari ini, Sudah lebih 20 Tahun kami melayani Anda. PELANGGAN Pelanggan Kami dari awal 99% adalah Perusahaan, Bagaimana dengan usaha Anda ? PRODUK -Produk CPANEL terbaru yg mendukung Mail, Website sebagai Produk Standart yang mendukung HTML, PHP s/d 7.4.x dan MySQL. -Produk…

Pengiklan: Septi Rahmawatisari, Alamat: jakarta pusat, Kontak: 083898019280
Link: Link Website Tags: Web Hosting, domain, mai, webhosting, webmail, hosting
WhatsApp-Button